SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g46781

Feature Type:gene_model
Chromosome:Gm06
Start:49348476
stop:49354343
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g46781
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03650AT Annotation by Michelle Graham. TAIR10: starch branching enzyme 2.2 | chr5:931924-937470 FORWARD LENGTH=805 SoyBaseE_val: 4.00E-17ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0010021GO-bp Annotation by Michelle Graham. GO Biological Process: amylopectin biosynthetic process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019760GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate metabolic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003844GO-mf Annotation by Michelle Graham. GO Molecular Function: 1,4-alpha-glucan branching enzyme activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
UniRef100_Q9XIS5UniRef Annotation by Michelle Graham. Best UniRef hit: Starch branching enzyme n=3 Tax=Phaseolus vulgaris RepID=Q9XIS5_PHAVU SoyBaseE_val: 7.00E-16ISS
UniRef100_Q9XIS5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Starch branching enzyme n=3 Tax=Phaseolus vulgaris RepID=Q9XIS5_PHAVU SoyBaseE_val: 7.00E-16ISS

Expression Patterns of Glyma06g46781
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g46781 not represented in the dataset
Glyma06g46781 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g46781 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g310900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g46781
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g46781
>Glyma06g46781.1   sequence type=CDS   gene model=Glyma06g46781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATACTCCCTCTGGAATCAAGGACTCAATTCCTGCTTGGATTAAATTTGCTGTACAGGCTCCCGGTGAAATTCCATACAGCGGAATATACTATGATCCCCTAGAAGAGAACTCATGCGTTGCCCCCCTAATAGAGGACCTGAAGGTTCGATGCGAACGACGACGGAAAAATCTCCTCGGTGTAAGCAGCAATTTTGGGGGGTCATACATGCATATATCACATGATTGA
Predicted protein sequences of Glyma06g46781
>Glyma06g46781.1   sequence type=predicted peptide   gene model=Glyma06g46781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDTPSGIKDSIPAWIKFAVQAPGEIPYSGIYYDPLEENSCVAPLIEDLKVRCERRRKNLLGVSSNFGGSYMHISHD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo